PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37806.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 274aa    MW: 31810.9 Da    PI: 7.5522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37806.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66e-181663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l+++v+ +G g+W+  +++ g++R +k+c++rw++yl
       KHN37806.1 16 RGAWSAEEDQILINYVQAHGEGNWRELSKRAGLKRRGKSCRLRWLNYL 63
                     89******************************99************97 PP

2Myb_DNA-binding51.13.2e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++ +lG++ W++Ia +++ gRt++++k++w++yl
       KHN37806.1  69 RGNISSDEEDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTYL 114
                      78999*****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1511163IPR017930Myb domain
SMARTSM007172.2E-151565IPR001005SANT/Myb domain
SuperFamilySSF466891.5E-2915110IPR009057Homeodomain-like
PfamPF002491.0E-161663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-231770IPR009057Homeodomain-like
CDDcd001676.12E-111863No hitNo description
PROSITE profilePS5129425.42164118IPR017930Myb domain
SMARTSM007171.7E-1568116IPR001005SANT/Myb domain
PfamPF002499.9E-1569114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2471117IPR009057Homeodomain-like
CDDcd001673.81E-1073114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MKRKAMSCDN RDAVNRGAWS AEEDQILINY VQAHGEGNWR ELSKRAGLKR RGKSCRLRWL  60
NYLKPDIKRG NISSDEEDLI IRLHSLLGNR WSLIAGRLPG RTDNEIKNYW NTYLRKKTEH  120
KDKHNKILSH NNNIPIKLRI ESPQCSKNSS GNVLDPAKSP HPMRCTKVMM PVNDSVNTMN  180
LIATSWENHN PSASMPLDDH NHCLTGVLQD LDISDLLMSY EDDCRFNGYA CVEIPQHIFK  240
DETWRLDDSM GEEAWYENWK IDTYFPQDMG FSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14753LKRRGKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535515.10.0PREDICTED: transcription factor TT2-like
SwissprotQ9FJA22e-54TT2_ARATH; Transcription factor TT2
TrEMBLA0A0B2RTS80.0A0A0B2RTS8_GLYSO; Transcription factor TT2
STRINGGLYMA10G35061.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15511512
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-55MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]